PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.J967R
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB
Protein Properties Length: 352aa    MW: 39055.2 Da    PI: 6.9432
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.J967RgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding635.9e-201764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l+d++k++G g+W++ +++ g++R++k+c++rw +yl
      Aradu.J967R 17 KGPWTAEEDEKLIDYIKKHGHGSWRSLSKRAGLNRCGKSCRLRWANYL 64
                     79********************************************97 PP

2Myb_DNA-binding57.14.1e-1870114147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T++E+ ++v+++ +lG++ W++Ia++++ gRt++++k++w+++
      Aradu.J967R  70 RGKFTPDEERIIVNLHSLLGNK-WSKIASHLP-GRTDNEIKNFWNTH 114
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.8581264IPR017930Myb domain
SuperFamilySSF466891.31E-3214111IPR009057Homeodomain-like
SMARTSM007179.8E-171666IPR001005SANT/Myb domain
PfamPF002492.6E-181764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-251871IPR009057Homeodomain-like
CDDcd001677.73E-141964No hitNo description
PROSITE profilePS5129427.97465119IPR017930Myb domain
SMARTSM007173.8E-1769117IPR001005SANT/Myb domain
PfamPF002491.9E-1670114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-2772119IPR009057Homeodomain-like
CDDcd001673.63E-1372115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MGRSPCCDES SGNNVKKGPW TAEEDEKLID YIKKHGHGSW RSLSKRAGLN RCGKSCRLRW  60
ANYLRPDIKR GKFTPDEERI IVNLHSLLGN KWSKIASHLP GRTDNEIKNF WNTHIRKKLL  120
QMGIDPDTHK PRTDFNHLIN LTHLLAAAMS SNSGNPMMNM NTPTWGRNPN IALQGDVTSQ  180
LSQLHLLQNL LQIMNSNTFV NMGNSNPNYN PSFDNSYLNE SNTLQAVGLK SEGHANNPAA  240
LFSHQHGGGA VNNTQEISSQ GNEEENPLLP ALVASSPVVS DGTCSSFNQM ENNNNSSCCN  300
TAPTSTTQSP NNSSTIFDDL EMLLQDDQTS DSYWKDILNF TSTYTSASTN SW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-31171197108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015963117.10.0PREDICTED: transcription factor MYB39-like
TrEMBLI1L4Y61e-126I1L4Y6_SOYBN; Uncharacterized protein
STRINGGLYMA09G33870.11e-126(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.25e-79myb domain protein 9